Mensuel Shaarli

Tous les liens d'un mois sur une page.

June, 2023

DropReference
thumbnail

Fais ta config...

Torrent Fr
  • Torrent9234 - Video / Audio / Software / Games / Roms / Books
  • Torrent911 - Video / Audio / Software / Games / Roms / Books
  • OxTorrent - Video / Audio / Software / Games / Roms / Books
  • Cpasbien - Video / Audio / Books / Software / Games / ROMs
  • Zetorrents - Video / Audio / Software / Games / ROMs / Books
  • Torrent411 - Video / Audio / Software / Games / ROMs / Books
  • Sharewood - Video / Audio / Software / Games / ROMs / Books
Sites Download Fr
Tout pour la 3D
Wallpapers

Wallpapers

UnixPornHD wallpapersWallpaperFusionWallpaperAccessWallpapers.comWallpaper SafariCoolBackgroundsWallpaperCavePositron DreamWalLegendSkinBaseGetWallsWallpapersDualMonitorBackgroundsSocWallThewWallpapersWPGallerywallpaperstockvlad.studioBing WallpapersimpledesktopsMac Wallpapers 2Microsoft Wallpapers / 23WallpaperHubWallpaper TipWallpaperFlarehdqwallsuhdpaperwallpapersdenMovieManiaXbox Wallpapersvsthemeswallpaperscraftbackieehdwallpaperswallpaper-housepixelstalk7-themesgettywallpaperswallpapersetwallpapershometeahubsfwallpaper99imageswallpaperbetterwallpaperforuwallpapercrafterwallpapersmuggoldposterpikisthdwallsboxwallpaperbatwallhereilikewallpaperwallupsetaswallpeakpxitlpaperspixel4ksuwallsGDrive Collectiondrawstructureps4wallpaperswallha4kwallpaperswallpaperswidewallpaper.dogMoeWallsdwt1

Telegram Wallpaper Channels

wallpapersull_HD_4K_wallpapersWallpapersGrampicsart_hd_backgroundAnime_WallpapersHDallwallpaperWallpaperZedgeImagesBotpicsart_hd_backgroundwallpaperselectionHk3ToG_WallsEZwallspengwynwallpapersite

Animated Wallpapers

  • ⭐ LWP - Wallpapers that Move with Cursor

/r/LivingBackgroundswallpaperwaifuScenic IllustrationsMyLiveWallpapersAutoWallAnimatedBackgroundsLively (Create)

Wallpaper Managers

ScreenPlaybackieeDaily Reddit WallpaperDaily Bing WallpaperAwesome Wallpapertanck.nlSuperPaper

Mobile Wallpapers

Wallpaper Enginewallhavenwallpaperfusionwallpaperaccesswallpapers.comwallpapersafariwallpapercavepositrondreamwallpaperstocksimpledesktopswallpapertipwallpaperflarehdqwallswallpapersdenmoviemaniaiOS Wallpapers / 2VectorifyDaHomebackieeWallpapers_Phone_Mobileiphone11papersWallpapers ClanWallmeWallYouMobcupAbsolutely Wallsnoir arts/r/iWallpaperWalliApp/r/Verticalwallpapers/r/MobileWallpaperZedge

Sous titrage
Streaming Fr
ISO Windows

Untouched ISOs

Modded ISOs

Roms Switch
Gestionnaires de Paquet
Jellyfin
Plex
Jeux DOS
Renommer des fichiers
Bookmarklet Combiner

Pour combiner des Bookmarklets

DiskCopy

Un freeware pour dupliquer vos disques dur / clefs USB

Capture2Text
Apprendre la programmation avec Delphi - Apprendre Delphi
thumbnail
Anti-Malware Toolkit - Lunarsoft Wiki
Xbox 360 Controller Emulator
DS4Windows - Tool to Use PS4/PS5 Controller on Windows PC
thumbnail
Indie Retro News

Ce site recense les sorties de jeux récents... sur d'anciennes plateforme. Oui il y a encore des développeurs qui sortent des jeux pour d'anciennes plateformes: C64, ZX81, ZX Spectrum, Amiga, MSX...

Simplix Pack to update Live Win7 System/ Integrate hotfixes into Win7 distribution | My Digital Life Forums
thumbnail

Pack d'updates Microsoft pour Windows 7 et Serveur 2008

Medicat USB
thumbnail
Releases · badele/tea-colors
thumbnail

Création d'un outil pour visualiser les couleurs de son terminal

GitHub - Sycnex/Windows10Debloater: Script to remove Windows 10 bloatware.
thumbnail
Pretty Powershell

Pour avoir un joli powershell

Windows Repair Toolbox

Une autre boite à outils de dépannage

Nerd Fonts - Iconic font aggregator, glyphs/icons collection, & fonts patcher
thumbnail
GitHub - xemulat/XToolbox: XToolBox - A collection of 156+ Windows 10/11 optimization and tweaking apps!
thumbnail

Une Toolbox pour Windows

Apk Installer For Android Subsystem – Applications du Microsoft Store

Installez des applications android sous Windows 11

eBooks BDz
Search all GPOs in a domain for some text - DailySysAdmin | For all things IT!

Toi aussi tu galères à trouver la GPO qui fait telle ou telle action?

Et bien ce petit script Powershell te permet de chercher dans l'ensemble des GPO la référence que tu souhaites.

IPTV
Activation Windows
Windows 10/11 Debloater
Minecraft
Site HS?
Usage de l espace disque
Jeux en ligne
GitHub - massgravel/Microsoft-Activation-Scripts: A Windows and Office activator using HWID / KMS38 / Online KMS activation methods, with a focus on open-source code and fewer antivirus detections.
thumbnail
GitHub - ChrisTitusTech/winutil: Chris Titus Tech's Windows Utility - Install Programs, Tweaks, Fixes, and Updates
thumbnail

Toolbox en Powershell pour Windows

Peut se lancer via la commande
iwr -useb https://christitus.com/win | iex

Logiciel de dépannage informatique - Boîte A Outils (BAO)
thumbnail

Boite à outils pour dépanner votre PC

2023 Finalists | Best Illusion of the Year Contest